Plant Transcription Factor Database
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_8075_iso_5
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family MYB
Protein Properties Length: 515aa    MW: 57160.4 Da    PI: 5.9702
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
                                         SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
                      Myb_DNA-binding  3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                                         +W++eEd++l + ++ +G+++W+ Ia+++   +t  qc+ rw++yl
  cra_locus_8075_iso_5_len_2758_ver_3 31 SWSQEEDDILREQIRIHGTENWAIIASKFK-DKTTRQCRRRWFTYL 75
                                         6****************************9.*************97 PP

                                          TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
                      Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                                          rg W++eEd ll +a k +G++ W+ Ia+ +  gRt++ +k+r+ +
  cra_locus_8075_iso_5_len_2758_ver_3  81 RGGWSPEEDMLLCEAQKVFGNR-WTEIAKVVS-GRTDNAVKNRFTT 124
                                          789*******************.*********.**********976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.5672475IPR017930Myb domain
SMARTSM007176.0E-132877IPR001005SANT/Myb domain
CDDcd001674.72E-133175No hitNo description
PfamPF139212.6E-143292No hitNo description
PROSITE profilePS5129419.94576130IPR017930Myb domain
SMARTSM007171.2E-1480128IPR001005SANT/Myb domain
CDDcd001673.45E-1184125No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009553Biological Processembryo sac development
GO:0010052Biological Processguard cell differentiation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 515 aa     Download sequence    Send to blast
3D Structure ? help Back to Top
PDB ID Evalue Query Start Query End Hit Start Hit End Description
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
No. Start End Sequence
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00259DAPTransfer from AT2G02820Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015076726.10.0PREDICTED: myb-related protein A isoform X2
TrEMBLA0A068TVN30.0A0A068TVN3_COFCA; Uncharacterized protein
STRINGSolyc05g007160.2.10.0(Solanum lycopersicum)